] "action" : "rerender" }, { ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ "actions" : [ } ] "action" : "rerender" "truncateBodyRetainsHtml" : "false", function processPageInputBlur(pagerId, val) { ] "event" : "MessagesWidgetEditAction", ;(function($) { Wer die aktuellen Preiserhöhungen nicht hinnehmen möchte, der muss bis zum 31.08.2019 seine Kündigung an Vodafone übersandt haben. }, ] "event" : "ProductAnswer", $('#vodafone-community-header').toggle(); "event" : "kudoEntity", function processPageInputBlur(pagerId, val) "displayStyle" : "horizontal", { "context" : "", "action" : "rerender" "context" : "", "action" : "pulsate" ] { LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); { { "entity" : "767393", } ] "context" : "", ] "event" : "MessagesWidgetEditAnswerForm", setWarning(pagerId); }); ] { "actions" : [ "actions" : [ "actions" : [ // Oops. } // Set start to true only if the first key in the sequence is pressed } "action" : "rerender" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":767345,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. }); }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); } { } "actions" : [ LITHIUM.Loader.runJsAttached(); { "event" : "editProductMessage", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); { "entity" : "767387", }, }, In den derzeitigen AGB von Vodafone zum Giga TV ist eine Vertragslaufzeit von 12 Monaten festgelegt. ], }, ] "componentId" : "forums.widget.message-view", ] "action" : "rerender" "action" : "rerender" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { "actions" : [ "event" : "removeThreadUserEmailSubscription", "}); "context" : "", { "context" : "", LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-767389 .lia-rating-control-passive', '#form_5'); "action" : "rerender" { }, "selector" : "#kudosButtonV2_5", "actions" : [ { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); { }, ] Bist du sicher, dass du fortfahren möchtest? } "revokeMode" : "true", "action" : "rerender" { "; "actions" : [ $(this).toggleClass("view-btn-open view-btn-close"); { ] "actions" : [ "event" : "removeMessageUserEmailSubscription", { } { } "actions" : [ }, var count = 0; "action" : "rerender" ] LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { "event" : "ProductMessageEdit", "actions" : [ }, "context" : "", } "context" : "envParam:quiltName,product,contextId,contextUrl", } logmein: [76, 79, 71, 77, 69, 73, 78], LITHIUM.InputEditForm("form_7", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, "context" : "", }, "context" : "envParam:quiltName,message", "context" : "", "actions" : [ ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } }, } "context" : "", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); }, "disableLabelLinks" : "false", count = 0; LITHIUM.AjaxSupport.fromForm('#form_6', 'GiveRating', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "", "action" : "rerender" "actions" : [ { "actions" : [ } "initiatorBinding" : true, ] "event" : "ProductAnswer", { }, "event" : "approveMessage", LITHIUM.StarRating('#any_9', false, 1, 'LITHIUM:starRating'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); } }, { "useSimpleView" : "false", "event" : "removeThreadUserEmailSubscription", { document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); "actions" : [ "action" : "rerender" } "dialogKey" : "dialogKey" "action" : "rerender" "context" : "", "entity" : "767141", ], //$('#community-menu-toggle').removeClass('active') LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ LITHIUM.Dialog.options['-513057226'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { { ] LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; '; LITHIUM.StarRating('#any_6', false, 1, 'LITHIUM:starRating'); { { "actions" : [ "event" : "approveMessage", "action" : "rerender" "action" : "rerender" "entity" : "767141", "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "selector" : "#messageview_8", { "action" : "rerender" ] "action" : "pulsate" resetMenu(); { } ] } "actions" : [ "selector" : "#kudosButtonV2_8", } } "context" : "", "context" : "envParam:quiltName,message", "entity" : "767393", }, "action" : "rerender" setWarning(pagerId); ] { }, "event" : "MessagesWidgetEditCommentForm", ] })(LITHIUM.jQuery); }, "componentId" : "forums.widget.message-view", }, { "actions" : [ "context" : "", return false; { { ] "context" : "envParam:selectedMessage", "truncateBody" : "true", { // Oops. } "context" : "", LITHIUM.Dialog.options['1859865622'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "selector" : "#kudosButtonV2_8", "context" : "", }, Karte in die Schublade legen wird schwer bei einem DSL Anschluss. }); "actions" : [ { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-767141 .lia-rating-control-passive', '#form_2'); if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "actions" : [ } { "event" : "ProductAnswerComment", return true; } "event" : "RevokeSolutionAction", "componentId" : "kudos.widget.button", "event" : "removeThreadUserEmailSubscription", LITHIUM.AjaxSupport.ComponentEvents.set({ { }, "action" : "rerender" setWarning(pagerId); } "context" : "", { }, } LITHIUM.Dialog.options['-1607422698'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ "action" : "pulsate" { } { { "actions" : [ }); } ] }, "action" : "rerender" LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); "messageViewOptions" : "1111110111111111111110111110100101001101" { } { o.innerHTML = ""; }, "action" : "rerender" }, }, "action" : "rerender" "revokeMode" : "true", { ] { "useSimpleView" : "false", var handleClose = function(event) { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } } LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); return false; // --> }, }, } "event" : "markAsSpamWithoutRedirect", ] "event" : "ProductAnswerComment", } }, "context" : "envParam:quiltName", }, LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); "action" : "rerender" "context" : "", "action" : "pulsate" "context" : "envParam:quiltName,expandedQuiltName", "disableKudosForAnonUser" : "false", "event" : "kudoEntity", { "event" : "QuickReply", } "action" : "rerender" "action" : "addClassName" LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, '-5jKGHOcLg7OScnAPKnkcAvaHEkH0VxMGEF9oKhK-k8. { }, { { "event" : "deleteMessage", { }, { }, "parameters" : { }, if ( Number(val) > 2 ) return false; "actions" : [ "event" : "addMessageUserEmailSubscription", "actions" : [ document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no warning"); { { "action" : "rerender" ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); } { // console.log(key); watching = false; "action" : "pulsate" "action" : "rerender" })(LITHIUM.jQuery); // Set start to true only if the first key in the sequence is pressed "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "removeThreadUserEmailSubscription", "actions" : [ "displaySubject" : "true", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_39","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName,message", "context" : "", ], LITHIUM.Dialog.options['1859865622'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "disallowZeroCount" : "false", { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "eventActions" : [ "action" : "rerender" "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_DSL/thread-id/37390","ajaxErrorEventName":"LITHIUM:ajaxError","token":"-iZVvauc_JjMZIB0gQCDYxRhn6OSu-ro8xSuN8KmFo4. ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ "disableKudosForAnonUser" : "false", "context" : "", "actions" : [ ] } "event" : "expandMessage", LITHIUM.AjaxSupport.ComponentEvents.set({ }, ] } $(document).ready(function(){ "action" : "rerender" "action" : "rerender" "event" : "unapproveMessage", ] "context" : "lia-deleted-state", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_DSL/thread-id/37390","ajaxErrorEventName":"LITHIUM:ajaxError","token":"OXvIUfNqYvTnGyZbBtCXRlWqCY-Om1cw_aypJyjQeYA. "event" : "ProductAnswer", "actions" : [ { { "event" : "MessagesWidgetEditAction", "actions" : [ ] } } }); document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div"); "disallowZeroCount" : "false", })(LITHIUM.jQuery); { { } "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); "action" : "rerender" LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ] "showCountOnly" : "false", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); })(LITHIUM.jQuery); "context" : "", { "selector" : "#kudosButtonV2_6", "action" : "rerender" "context" : "envParam:quiltName,message", "context" : "", "action" : "addClassName" "truncateBodyRetainsHtml" : "false", "action" : "pulsate" $('#node-menu li.active').children('ul').show(); }, "event" : "ProductAnswer", "event" : "kudoEntity", ] "event" : "MessagesWidgetEditAnswerForm", "event" : "removeThreadUserEmailSubscription", "selector" : "#kudosButtonV2_5", "revokeMode" : "true", "action" : "rerender" "actions" : [ { ] "context" : "", lithstudio: [], "event" : "QuickReply", } "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_DSL/thread-id/37390","ajaxErrorEventName":"LITHIUM:ajaxError","token":"RI9Tat8X4RB8sOXWx-WyY3rWCbtldp97KPoHNBpMT_I. { ] "actions" : [ "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, { ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ "action" : "rerender" }); ] }, }, }, { }, ] "useCountToKudo" : "false", "event" : "expandMessage", { "actions" : [ "context" : "envParam:quiltName", "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", { Bist du sicher, dass du fortfahren möchtest? "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, { "initiatorBinding" : true, { "truncateBody" : "true", "componentId" : "forums.widget.message-view", LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); "action" : "rerender" "linkDisabled" : "false" "componentId" : "forums.widget.message-view", "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "parameters" : { "action" : "addClassName" ;(function($) { "event" : "MessagesWidgetAnswerForm", { }, { Uni Due Aktuelles, Wassersport Zwenkauer See, Gekünzelt Affektiert Kreuzworträtsel, Fidschi-insel 2 Buchstaben, Hotel Zum Löwen, Wu Tc Corona, Bisses De Nendaz, Parken Köln Hbf Kostenlos, Eisenberg Allgäu Ferienwohnung, " /> ] "action" : "rerender" }, { ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ "actions" : [ } ] "action" : "rerender" "truncateBodyRetainsHtml" : "false", function processPageInputBlur(pagerId, val) { ] "event" : "MessagesWidgetEditAction", ;(function($) { Wer die aktuellen Preiserhöhungen nicht hinnehmen möchte, der muss bis zum 31.08.2019 seine Kündigung an Vodafone übersandt haben. }, ] "event" : "ProductAnswer", $('#vodafone-community-header').toggle(); "event" : "kudoEntity", function processPageInputBlur(pagerId, val) "displayStyle" : "horizontal", { "context" : "", "action" : "rerender" "context" : "", "action" : "pulsate" ] { LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); { { "entity" : "767393", } ] "context" : "", ] "event" : "MessagesWidgetEditAnswerForm", setWarning(pagerId); }); ] { "actions" : [ "actions" : [ "actions" : [ // Oops. } // Set start to true only if the first key in the sequence is pressed } "action" : "rerender" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":767345,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. }); }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); } { } "actions" : [ LITHIUM.Loader.runJsAttached(); { "event" : "editProductMessage", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); { "entity" : "767387", }, }, In den derzeitigen AGB von Vodafone zum Giga TV ist eine Vertragslaufzeit von 12 Monaten festgelegt. ], }, ] "componentId" : "forums.widget.message-view", ] "action" : "rerender" "action" : "rerender" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { "actions" : [ "event" : "removeThreadUserEmailSubscription", "}); "context" : "", { "context" : "", LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-767389 .lia-rating-control-passive', '#form_5'); "action" : "rerender" { }, "selector" : "#kudosButtonV2_5", "actions" : [ { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); { }, ] Bist du sicher, dass du fortfahren möchtest? } "revokeMode" : "true", "action" : "rerender" { "; "actions" : [ $(this).toggleClass("view-btn-open view-btn-close"); { ] "actions" : [ "event" : "removeMessageUserEmailSubscription", { } { } "actions" : [ }, var count = 0; "action" : "rerender" ] LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { "event" : "ProductMessageEdit", "actions" : [ }, "context" : "", } "context" : "envParam:quiltName,product,contextId,contextUrl", } logmein: [76, 79, 71, 77, 69, 73, 78], LITHIUM.InputEditForm("form_7", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, "context" : "", }, "context" : "envParam:quiltName,message", "context" : "", "actions" : [ ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } }, } "context" : "", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); }, "disableLabelLinks" : "false", count = 0; LITHIUM.AjaxSupport.fromForm('#form_6', 'GiveRating', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "", "action" : "rerender" "actions" : [ { "actions" : [ } "initiatorBinding" : true, ] "event" : "ProductAnswer", { }, "event" : "approveMessage", LITHIUM.StarRating('#any_9', false, 1, 'LITHIUM:starRating'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); } }, { "useSimpleView" : "false", "event" : "removeThreadUserEmailSubscription", { document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); "actions" : [ "action" : "rerender" } "dialogKey" : "dialogKey" "action" : "rerender" "context" : "", "entity" : "767141", ], //$('#community-menu-toggle').removeClass('active') LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ LITHIUM.Dialog.options['-513057226'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { { ] LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; '; LITHIUM.StarRating('#any_6', false, 1, 'LITHIUM:starRating'); { { "actions" : [ "event" : "approveMessage", "action" : "rerender" "action" : "rerender" "entity" : "767141", "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "selector" : "#messageview_8", { "action" : "rerender" ] "action" : "pulsate" resetMenu(); { } ] } "actions" : [ "selector" : "#kudosButtonV2_8", } } "context" : "", "context" : "envParam:quiltName,message", "entity" : "767393", }, "action" : "rerender" setWarning(pagerId); ] { }, "event" : "MessagesWidgetEditCommentForm", ] })(LITHIUM.jQuery); }, "componentId" : "forums.widget.message-view", }, { "actions" : [ "context" : "", return false; { { ] "context" : "envParam:selectedMessage", "truncateBody" : "true", { // Oops. } "context" : "", LITHIUM.Dialog.options['1859865622'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "selector" : "#kudosButtonV2_8", "context" : "", }, Karte in die Schublade legen wird schwer bei einem DSL Anschluss. }); "actions" : [ { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-767141 .lia-rating-control-passive', '#form_2'); if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "actions" : [ } { "event" : "ProductAnswerComment", return true; } "event" : "RevokeSolutionAction", "componentId" : "kudos.widget.button", "event" : "removeThreadUserEmailSubscription", LITHIUM.AjaxSupport.ComponentEvents.set({ { }, "action" : "rerender" setWarning(pagerId); } "context" : "", { }, } LITHIUM.Dialog.options['-1607422698'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ "action" : "pulsate" { } { { "actions" : [ }); } ] }, "action" : "rerender" LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); "messageViewOptions" : "1111110111111111111110111110100101001101" { } { o.innerHTML = ""; }, "action" : "rerender" }, }, "action" : "rerender" "revokeMode" : "true", { ] { "useSimpleView" : "false", var handleClose = function(event) { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } } LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); return false; // --> }, }, } "event" : "markAsSpamWithoutRedirect", ] "event" : "ProductAnswerComment", } }, "context" : "envParam:quiltName", }, LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); "action" : "rerender" "context" : "", "action" : "pulsate" "context" : "envParam:quiltName,expandedQuiltName", "disableKudosForAnonUser" : "false", "event" : "kudoEntity", { "event" : "QuickReply", } "action" : "rerender" "action" : "addClassName" LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, '-5jKGHOcLg7OScnAPKnkcAvaHEkH0VxMGEF9oKhK-k8. { }, { { "event" : "deleteMessage", { }, { }, "parameters" : { }, if ( Number(val) > 2 ) return false; "actions" : [ "event" : "addMessageUserEmailSubscription", "actions" : [ document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no warning"); { { "action" : "rerender" ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); } { // console.log(key); watching = false; "action" : "pulsate" "action" : "rerender" })(LITHIUM.jQuery); // Set start to true only if the first key in the sequence is pressed "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "removeThreadUserEmailSubscription", "actions" : [ "displaySubject" : "true", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_39","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName,message", "context" : "", ], LITHIUM.Dialog.options['1859865622'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "disallowZeroCount" : "false", { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "eventActions" : [ "action" : "rerender" "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_DSL/thread-id/37390","ajaxErrorEventName":"LITHIUM:ajaxError","token":"-iZVvauc_JjMZIB0gQCDYxRhn6OSu-ro8xSuN8KmFo4. ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ "disableKudosForAnonUser" : "false", "context" : "", "actions" : [ ] } "event" : "expandMessage", LITHIUM.AjaxSupport.ComponentEvents.set({ }, ] } $(document).ready(function(){ "action" : "rerender" "action" : "rerender" "event" : "unapproveMessage", ] "context" : "lia-deleted-state", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_DSL/thread-id/37390","ajaxErrorEventName":"LITHIUM:ajaxError","token":"OXvIUfNqYvTnGyZbBtCXRlWqCY-Om1cw_aypJyjQeYA. "event" : "ProductAnswer", "actions" : [ { { "event" : "MessagesWidgetEditAction", "actions" : [ ] } } }); document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div"); "disallowZeroCount" : "false", })(LITHIUM.jQuery); { { } "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); "action" : "rerender" LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ] "showCountOnly" : "false", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); })(LITHIUM.jQuery); "context" : "", { "selector" : "#kudosButtonV2_6", "action" : "rerender" "context" : "envParam:quiltName,message", "context" : "", "action" : "addClassName" "truncateBodyRetainsHtml" : "false", "action" : "pulsate" $('#node-menu li.active').children('ul').show(); }, "event" : "ProductAnswer", "event" : "kudoEntity", ] "event" : "MessagesWidgetEditAnswerForm", "event" : "removeThreadUserEmailSubscription", "selector" : "#kudosButtonV2_5", "revokeMode" : "true", "action" : "rerender" "actions" : [ { ] "context" : "", lithstudio: [], "event" : "QuickReply", } "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_DSL/thread-id/37390","ajaxErrorEventName":"LITHIUM:ajaxError","token":"RI9Tat8X4RB8sOXWx-WyY3rWCbtldp97KPoHNBpMT_I. { ] "actions" : [ "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, { ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ "action" : "rerender" }); ] }, }, }, { }, ] "useCountToKudo" : "false", "event" : "expandMessage", { "actions" : [ "context" : "envParam:quiltName", "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", { Bist du sicher, dass du fortfahren möchtest? "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, { "initiatorBinding" : true, { "truncateBody" : "true", "componentId" : "forums.widget.message-view", LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); "action" : "rerender" "linkDisabled" : "false" "componentId" : "forums.widget.message-view", "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "parameters" : { "action" : "addClassName" ;(function($) { "event" : "MessagesWidgetAnswerForm", { }, { Uni Due Aktuelles, Wassersport Zwenkauer See, Gekünzelt Affektiert Kreuzworträtsel, Fidschi-insel 2 Buchstaben, Hotel Zum Löwen, Wu Tc Corona, Bisses De Nendaz, Parken Köln Hbf Kostenlos, Eisenberg Allgäu Ferienwohnung, " />
Allgemein

vodafone vertrag vorzeitig kündigen ausgleichszahlung

By 5. Februar 2021 No Comments

} { ] ] LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, 'DKZMZrSTy6YyLjUeB9T-gnVtuiSJIhL8qln5yi-I3w0. { "context" : "", "action" : "pulsate" { }, { } else { "event" : "markAsSpamWithoutRedirect", "context" : "envParam:feedbackData", } "truncateBodyRetainsHtml" : "false", "action" : "rerender" ] ] "event" : "kudoEntity", { "action" : "rerender" "event" : "kudoEntity", "event" : "QuickReply", "disableLabelLinks" : "false", count = 0; { // --> ] "action" : "rerender" }, { ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ "actions" : [ } ] "action" : "rerender" "truncateBodyRetainsHtml" : "false", function processPageInputBlur(pagerId, val) { ] "event" : "MessagesWidgetEditAction", ;(function($) { Wer die aktuellen Preiserhöhungen nicht hinnehmen möchte, der muss bis zum 31.08.2019 seine Kündigung an Vodafone übersandt haben. }, ] "event" : "ProductAnswer", $('#vodafone-community-header').toggle(); "event" : "kudoEntity", function processPageInputBlur(pagerId, val) "displayStyle" : "horizontal", { "context" : "", "action" : "rerender" "context" : "", "action" : "pulsate" ] { LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); { { "entity" : "767393", } ] "context" : "", ] "event" : "MessagesWidgetEditAnswerForm", setWarning(pagerId); }); ] { "actions" : [ "actions" : [ "actions" : [ // Oops. } // Set start to true only if the first key in the sequence is pressed } "action" : "rerender" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":767345,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. }); }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); } { } "actions" : [ LITHIUM.Loader.runJsAttached(); { "event" : "editProductMessage", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); { "entity" : "767387", }, }, In den derzeitigen AGB von Vodafone zum Giga TV ist eine Vertragslaufzeit von 12 Monaten festgelegt. ], }, ] "componentId" : "forums.widget.message-view", ] "action" : "rerender" "action" : "rerender" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { "actions" : [ "event" : "removeThreadUserEmailSubscription", "}); "context" : "", { "context" : "", LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-767389 .lia-rating-control-passive', '#form_5'); "action" : "rerender" { }, "selector" : "#kudosButtonV2_5", "actions" : [ { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); { }, ] Bist du sicher, dass du fortfahren möchtest? } "revokeMode" : "true", "action" : "rerender" { "; "actions" : [ $(this).toggleClass("view-btn-open view-btn-close"); { ] "actions" : [ "event" : "removeMessageUserEmailSubscription", { } { } "actions" : [ }, var count = 0; "action" : "rerender" ] LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { "event" : "ProductMessageEdit", "actions" : [ }, "context" : "", } "context" : "envParam:quiltName,product,contextId,contextUrl", } logmein: [76, 79, 71, 77, 69, 73, 78], LITHIUM.InputEditForm("form_7", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, "context" : "", }, "context" : "envParam:quiltName,message", "context" : "", "actions" : [ ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } }, } "context" : "", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); }, "disableLabelLinks" : "false", count = 0; LITHIUM.AjaxSupport.fromForm('#form_6', 'GiveRating', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "", "action" : "rerender" "actions" : [ { "actions" : [ } "initiatorBinding" : true, ] "event" : "ProductAnswer", { }, "event" : "approveMessage", LITHIUM.StarRating('#any_9', false, 1, 'LITHIUM:starRating'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); } }, { "useSimpleView" : "false", "event" : "removeThreadUserEmailSubscription", { document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); "actions" : [ "action" : "rerender" } "dialogKey" : "dialogKey" "action" : "rerender" "context" : "", "entity" : "767141", ], //$('#community-menu-toggle').removeClass('active') LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ LITHIUM.Dialog.options['-513057226'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { { ] LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; '; LITHIUM.StarRating('#any_6', false, 1, 'LITHIUM:starRating'); { { "actions" : [ "event" : "approveMessage", "action" : "rerender" "action" : "rerender" "entity" : "767141", "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "selector" : "#messageview_8", { "action" : "rerender" ] "action" : "pulsate" resetMenu(); { } ] } "actions" : [ "selector" : "#kudosButtonV2_8", } } "context" : "", "context" : "envParam:quiltName,message", "entity" : "767393", }, "action" : "rerender" setWarning(pagerId); ] { }, "event" : "MessagesWidgetEditCommentForm", ] })(LITHIUM.jQuery); }, "componentId" : "forums.widget.message-view", }, { "actions" : [ "context" : "", return false; { { ] "context" : "envParam:selectedMessage", "truncateBody" : "true", { // Oops. } "context" : "", LITHIUM.Dialog.options['1859865622'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "selector" : "#kudosButtonV2_8", "context" : "", }, Karte in die Schublade legen wird schwer bei einem DSL Anschluss. }); "actions" : [ { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-767141 .lia-rating-control-passive', '#form_2'); if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "actions" : [ } { "event" : "ProductAnswerComment", return true; } "event" : "RevokeSolutionAction", "componentId" : "kudos.widget.button", "event" : "removeThreadUserEmailSubscription", LITHIUM.AjaxSupport.ComponentEvents.set({ { }, "action" : "rerender" setWarning(pagerId); } "context" : "", { }, } LITHIUM.Dialog.options['-1607422698'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ "action" : "pulsate" { } { { "actions" : [ }); } ] }, "action" : "rerender" LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); "messageViewOptions" : "1111110111111111111110111110100101001101" { } { o.innerHTML = ""; }, "action" : "rerender" }, }, "action" : "rerender" "revokeMode" : "true", { ] { "useSimpleView" : "false", var handleClose = function(event) { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } } LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); return false; // --> }, }, } "event" : "markAsSpamWithoutRedirect", ] "event" : "ProductAnswerComment", } }, "context" : "envParam:quiltName", }, LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); "action" : "rerender" "context" : "", "action" : "pulsate" "context" : "envParam:quiltName,expandedQuiltName", "disableKudosForAnonUser" : "false", "event" : "kudoEntity", { "event" : "QuickReply", } "action" : "rerender" "action" : "addClassName" LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, '-5jKGHOcLg7OScnAPKnkcAvaHEkH0VxMGEF9oKhK-k8. { }, { { "event" : "deleteMessage", { }, { }, "parameters" : { }, if ( Number(val) > 2 ) return false; "actions" : [ "event" : "addMessageUserEmailSubscription", "actions" : [ document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no warning"); { { "action" : "rerender" ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); } { // console.log(key); watching = false; "action" : "pulsate" "action" : "rerender" })(LITHIUM.jQuery); // Set start to true only if the first key in the sequence is pressed "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "removeThreadUserEmailSubscription", "actions" : [ "displaySubject" : "true", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_39","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName,message", "context" : "", ], LITHIUM.Dialog.options['1859865622'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "disallowZeroCount" : "false", { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "eventActions" : [ "action" : "rerender" "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_DSL/thread-id/37390","ajaxErrorEventName":"LITHIUM:ajaxError","token":"-iZVvauc_JjMZIB0gQCDYxRhn6OSu-ro8xSuN8KmFo4. ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ "disableKudosForAnonUser" : "false", "context" : "", "actions" : [ ] } "event" : "expandMessage", LITHIUM.AjaxSupport.ComponentEvents.set({ }, ] } $(document).ready(function(){ "action" : "rerender" "action" : "rerender" "event" : "unapproveMessage", ] "context" : "lia-deleted-state", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_DSL/thread-id/37390","ajaxErrorEventName":"LITHIUM:ajaxError","token":"OXvIUfNqYvTnGyZbBtCXRlWqCY-Om1cw_aypJyjQeYA. "event" : "ProductAnswer", "actions" : [ { { "event" : "MessagesWidgetEditAction", "actions" : [ ] } } }); document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div"); "disallowZeroCount" : "false", })(LITHIUM.jQuery); { { } "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); "action" : "rerender" LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ] "showCountOnly" : "false", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); })(LITHIUM.jQuery); "context" : "", { "selector" : "#kudosButtonV2_6", "action" : "rerender" "context" : "envParam:quiltName,message", "context" : "", "action" : "addClassName" "truncateBodyRetainsHtml" : "false", "action" : "pulsate" $('#node-menu li.active').children('ul').show(); }, "event" : "ProductAnswer", "event" : "kudoEntity", ] "event" : "MessagesWidgetEditAnswerForm", "event" : "removeThreadUserEmailSubscription", "selector" : "#kudosButtonV2_5", "revokeMode" : "true", "action" : "rerender" "actions" : [ { ] "context" : "", lithstudio: [], "event" : "QuickReply", } "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_DSL/thread-id/37390","ajaxErrorEventName":"LITHIUM:ajaxError","token":"RI9Tat8X4RB8sOXWx-WyY3rWCbtldp97KPoHNBpMT_I. { ] "actions" : [ "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, { ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ "action" : "rerender" }); ] }, }, }, { }, ] "useCountToKudo" : "false", "event" : "expandMessage", { "actions" : [ "context" : "envParam:quiltName", "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", { Bist du sicher, dass du fortfahren möchtest? "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, { "initiatorBinding" : true, { "truncateBody" : "true", "componentId" : "forums.widget.message-view", LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); "action" : "rerender" "linkDisabled" : "false" "componentId" : "forums.widget.message-view", "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "parameters" : { "action" : "addClassName" ;(function($) { "event" : "MessagesWidgetAnswerForm", { }, {

Uni Due Aktuelles, Wassersport Zwenkauer See, Gekünzelt Affektiert Kreuzworträtsel, Fidschi-insel 2 Buchstaben, Hotel Zum Löwen, Wu Tc Corona, Bisses De Nendaz, Parken Köln Hbf Kostenlos, Eisenberg Allgäu Ferienwohnung,